-
1 animated GIF
"A series of graphic images in GIF format, displayed sequentially in a single location to give the appearance of a moving picture." -
2 gráfico
adj.graphic, graphical, pictorial.m.graphic, graph, diagram, chart.* * *► adjetivo1 graphic1 (dibujo) sketch, chart\artes gráficas graphic arts————————1 (dibujo) sketch, chart* * *1. noun m.1) graph, chart2) graphic2. (f. - gráfica)adj.* * *1. ADJ1) [diseño, artes] graphicinformación gráfica — photographs pl, pictures pl
2) [descripción, relato] graphic2. SM1) (=diagrama) chart; (Mat) graphgráfico de sectores, gráfico de tarta — pie chart
2) pl gráficos (Inform) graphics* * *I- ca adjetivoa) (Art, Impr) graphicb) <relato/narración> graphic; < gesto> expressiveIIa) (Mat) graphb) (Inf) graphic* * *I- ca adjetivoa) (Art, Impr) graphicb) <relato/narración> graphic; < gesto> expressiveIIa) (Mat) graphb) (Inf) graphic* * *gráfico11 = graphic.Nota: Un gráfico es una representación bidimensional opaca (ej., una fotografía o un dibujo técnico) o para ser proyectada (ej., una filmina).Ex: A graphic is a two-dimensional representation whether opaque (e.g., art originals and reproductions, flash cards, photographs, technical drawings) or intended to be viewed, or projected, without motion, by means of an optical device (e.g., filmstrips, stereographs, slides).
* gráfico animado = motion graphic.* gráfico de flechas = arrowgraph.* gráfico de tarta = pie chart.* gráfico en movimiento = animated graphic.* gráfico en vídeo = video graphic.* gráfico fijo = still graphic.* graficos en movimiento = animated media.* gráficos por ordenador = computer graphics.* interfaz por medio de gráficos = graphics interfacing.* menú de herramientas para trabajar con gráficos = tool palette.* tarjeta de gráficos = graphics card.gráfico22 = diagrammatic, graphic, pictorial, figurative, graphical, representational.Ex: Diagrammatic presentation of the layout of the collection conveniently placed, for example, near the entrance.
Ex: In addition, 10 non-bibliographic CD-ROMs, containing full-text, numeric or graphic data, were acquired and evaluated.Ex: Forms of symbol used for presentation are: 1 language, eg Arabic; 2 mathematical, eg. graphs, formulae; 3 pictorial, eg drawings.Ex: The system, called 'T-Search', includes not only automatic phonetic searching but also capabilities of full text search and couples them with the capability to search the figurative elements of trademarks.Ex: There are learning advantages in using a graphical rather than a linear approach to the presentation of material in information systems.Ex: 'Data base' is a term referring to machine-readable collections of information, whether numerical, representational or bibliographic.* alfabetización gráfica = graphic literacy.* artes gráficas, las = graphic arts, the.* capacidad de interpretar información gráfica = graphic literacy.* diseñador gráfico = graphic artist, graphic designer.* diseño gráfico = graphic design.* ecualizador gráfico = graphic equaliser.* GUI (Interfaze Gráfico de Usuario) = GUI (Graphic User Interface).* guión gráfico = storyboard.* historieta gráfica = cartoon.* interfaz gráfico de consulta imprecisa = graphical browser.* material gráfico = graphic material.* presentación gráfica de términos permutados = permuted display.* representación gráfica = graphic display.* taller gráfico = printing company, printing press, printing firm, printing house.* * *talleres gráficos Anaya Anaya press, Anaya printing house2 ‹relato/narración› graphic; ‹gesto› expressive1 ( Mat) graph2 ( Inf) graphicCompuestos:bar chartcomputer graphicmasculine, feminine( RPl) printer* * *
gráfico 1◊ -ca adjetivo
graphic;
‹ gesto› expressive
gráfico 2 sustantivo masculinoa) (Mat) graphb) (Inf) graphic
gráfico,-a
I adjetivo graphic
diseño gráfico, graphic design
gráfico de tarta, pie chart
II sustantivo masculino y femenino graph
' gráfico' also found in these entries:
Spanish:
cuadro
- gráfica
- humorista
- reportaje
- periodista
- pico
- reportero
- tabla
English:
apostrophe
- artwork
- bar chart
- chart
- diagram
- graph
- graphic
- graphic account
- graphic design
- graphic designer
- photojournalism
- pie chart
- square
- storyboard
- vivid
- ball
- cartoon
- graphics
- press
- wall
* * *gráfico, -a♦ adj1. [de la imprenta] graphic;artes gráficas graphic arts2. [con signos, dibujos] graphic;una representación gráfica a graph;diseño gráfico graphic design3. [con imágenes] graphic;un reportaje gráfico a photo story, an illustrated feature;un reportero gráfico a press photographer4. [expresivo, claro] graphic;hizo un gesto muy gráfico he made a very expressive gesture;lo explicó de una manera muy gráfica she explained it very graphically♦ nm[figura] graph, chart; [dibujo] diagram gráfico de barras bar chart;gráfico circular pie chart;Am gráficos de computadora computer graphics; Esp gráficos de ordenador computer graphics;gráficos para presentaciones presentation o business graphics;gráfico de sectores pie chart;gráfico de tarta pie chart;gráficos vectoriales vector graphics♦ nm,fRP printer* * *I adj graphic;artes gráficas graphic artsII m1 MAT graph2 INFOR graphic* * *gráfico, -ca adj: graphic♦ gráficamente advgráfico nm1) : graph, chart2) : graphic (for a computer, etc.)3)gráfico de barras : bar graph* * *gráfico1 adj graphicgráfico2 n graph -
3 gráfico1
1 = graphic.Nota: Un gráfico es una representación bidimensional opaca (ej., una fotografía o un dibujo técnico) o para ser proyectada (ej., una filmina).Ex. A graphic is a two-dimensional representation whether opaque (e.g., art originals and reproductions, flash cards, photographs, technical drawings) or intended to be viewed, or projected, without motion, by means of an optical device (e.g., filmstrips, stereographs, slides).----* gráfico animado = motion graphic.* gráfico de flechas = arrowgraph.* gráfico de tarta = pie chart.* gráfico en movimiento = animated graphic.* gráfico en vídeo = video graphic.* gráfico fijo = still graphic.* graficos en movimiento = animated media.* gráficos por ordenador = computer graphics.* interfaz por medio de gráficos = graphics interfacing.* menú de herramientas para trabajar con gráficos = tool palette.* tarjeta de gráficos = graphics card. -
4 gráfico en movimiento
(n.) = animated graphicEx. Different media will be supported: text, still graphics, animated graphics, sound, still images, video images, etc.* * *(n.) = animated graphicEx: Different media will be supported: text, still graphics, animated graphics, sound, still images, video images, etc.
-
5 movimiento1
1 = flow, motion, move, navigation, shift, stream of traffic, mechanical stress, movement.Ex. The vocabulary used in conjunction with PRECIS is split in two sections, one part for Entities (or things) and the other for Attributes (properties of things, for example colour, weight; activities of things, for example flow, and properties of activities, for example, slow, turbulent).Ex. For instance 'Sculpture-Technique' precedes 'Sculpture in motion'.Ex. Better flexibility is achieved if the heating, ventilation and lighting can accommodate this move without the need for any alterations.Ex. The function of the index is examined both technically and philosophically as a tool for navigation and spatial orientation in large textual data bases.Ex. Transitory circumstances of daily life are what cause these shifts.Ex. Laura Carpozzi head of the circulation department, who was on the far side of the desk, heard the checker's outburst and espied the bottleneck in the stream of traffic.Ex. This type of non-skid polyurethane flooring is hygienic and resistant to chemical substances and mechanical stress.Ex. She is a dynamic dancer and expresses her movements with ultimate power.----* blanco en movimiento = moving target.* con figuras en movimiento = animated.* con imágenes en movimiento = animated.* de movimientos rápidos = quick-moving.* de movimiento total = full-motion.* detectar el movimiento = detect + motion.* dispositivo de control del movimiento del cursor = cursor-control device.* documento de imagen en movimiento = moving image document.* el movimiento se demuestra andando = actions speak louder than words.* en constante movimiento = on the move, on the go.* en movimiento = in transit, on the go, moving.* gráfico en movimiento = animated graphic.* graficos en movimiento = animated media.* hacer un movimiento en falso = make + a false move.* horas de poco movimiento = slack hours.* imagen en movimiento = moving image, animated image.* imágenes en movimiento = animation.* libertad de movimiento = freedom of movement.* mantener las cosas en movimiento = keep + the ball rolling, keep + it rolling.* movimiento de fondo = groundswell.* movimiento de la población = population turnover, population transfer.* movimiento de libros = bookshift.* movimiento de personal = staff turnover, turnover, labour turnover.* movimiento de tierra = earthwork.* movimiento en falso = false move.* movimiento oscilante = rocking motion.* movimiento peatonal = foot traffic.* movimientos de efectivos = cash flow.* poner las cosas en movimiento = get + the ball rolling, set + the ball rolling, start + the ball rolling, get + things rolling, get + things going, set + the wheels in motion.* razones del movimiento de personal = turnover behaviour.* reconocedor del movimiento de los ojos = eye tracker.* ritmo de movimiento de mercancías = turnover rate.* ritmo de movimiento de personal = turnover rate.* sin movimiento = unmoving, motionless.* tasa de movimiento de mercancías = turnover rate.* tasa de movimiento de personal = turnover rate.* tecla de control del movimiento horizontal = horizontal positioning key.* tecla de control del movimiento vertical = vertical positioning key. -
6 movimiento
m.1 movement (desplazamiento, corriente).movimiento obrero working-class movement2 motion (physics & mechanics).en movimiento moving, in motionponerse en movimiento to start movingmovimiento continuo/de rotación perpetual/rotational motionmovimiento sísmico earth tremor3 activity.4 turnover.movimiento de capital cash flow5 movement (Music) (parte de la obra).6 move, forward movement, step in a process.* * *1 (gen) movement; (técnicamente) motion2 (de gente, ideas) activity; (de vehículos) traffic3 (artístico, político) movement4 (financiero) operations plural6 el Movimiento the Falangist Movement\en movimiento in motionmovimiento de caja turnovermovimiento sísmico earth tremor* * *noun m.1) movement2) motion* * *SM1) (Mec, Fís) movement•
movimiento hacia abajo/arriba — downward/upward movementmovimiento continuo — continuous movement, continuous motion
movimiento de traslación — orbital movement o motion
movimiento ondulatorio — wave movement, wave motion
2) (=desplazamiento) [de persona, animal] movementno hagas ningún movimiento — don't move a muscle, don't make a move
¡un movimiento en falso y disparo! — one false move and I'll shoot!
3)• en movimiento — [figura, persona] moving; [vehículo] in motion
una célula en movimiento — a moving cell o a cell in motion
está siempre en movimiento — (fig) she's always on the move o go *
mantener algo en movimiento — to keep sth moving o in motion
•
poner en movimiento — [+ máquina, motor] to set in motion; [+ vehículo] to get going; [+ actividad, negocio] to start, start up4) (Econ, Com) [de cuenta] transaction; [de dinero] movement¿puedo consultar los movimientos de mi cuenta? — can I have a statement of my account?
"últimos movimientos" — "latest transactions"
movimiento de mercancías — turnover, volume of business
5) (=actividad) [en oficina, tribunal] activity; [en aeropuerto, carretera] trafficel movimiento de pasajeros ha sido intenso estos días — passenger traffic has been very heavy in recent days
movimiento máximo — (Aut) peak traffic
6) (=tendencia) movementel Movimiento (Nacional) — Esp ( Hist) the Falangist Movement
7) (Mús) [de compás] tempo; [de sinfonía] movement8) (Inform)9) (=jugada) move* * *1)a) (Fís, Tec) motion, movementb) ( desplazamiento) movementc) (cambio de postura, posición) movement2)a) (traslado - de dinero, bienes) movement; (- de la población) shiftb) (variación, cambio) movement, changec) (agitación, actividad) activity3)a) (corriente, tendencia) movementb) ( organización) movement4) ( alzamiento) uprising, rebellion5) (Mús) ( parte de obra) movement; ( compás) tempo6) (Jueg) move* * *1)a) (Fís, Tec) motion, movementb) ( desplazamiento) movementc) (cambio de postura, posición) movement2)a) (traslado - de dinero, bienes) movement; (- de la población) shiftb) (variación, cambio) movement, changec) (agitación, actividad) activity3)a) (corriente, tendencia) movementb) ( organización) movement4) ( alzamiento) uprising, rebellion5) (Mús) ( parte de obra) movement; ( compás) tempo6) (Jueg) move* * *movimiento11 = flow, motion, move, navigation, shift, stream of traffic, mechanical stress, movement.Ex: The vocabulary used in conjunction with PRECIS is split in two sections, one part for Entities (or things) and the other for Attributes (properties of things, for example colour, weight; activities of things, for example flow, and properties of activities, for example, slow, turbulent).
Ex: For instance 'Sculpture-Technique' precedes 'Sculpture in motion'.Ex: Better flexibility is achieved if the heating, ventilation and lighting can accommodate this move without the need for any alterations.Ex: The function of the index is examined both technically and philosophically as a tool for navigation and spatial orientation in large textual data bases.Ex: Transitory circumstances of daily life are what cause these shifts.Ex: Laura Carpozzi head of the circulation department, who was on the far side of the desk, heard the checker's outburst and espied the bottleneck in the stream of traffic.Ex: This type of non-skid polyurethane flooring is hygienic and resistant to chemical substances and mechanical stress.Ex: She is a dynamic dancer and expresses her movements with ultimate power.* blanco en movimiento = moving target.* con figuras en movimiento = animated.* con imágenes en movimiento = animated.* de movimientos rápidos = quick-moving.* de movimiento total = full-motion.* detectar el movimiento = detect + motion.* dispositivo de control del movimiento del cursor = cursor-control device.* documento de imagen en movimiento = moving image document.* el movimiento se demuestra andando = actions speak louder than words.* en constante movimiento = on the move, on the go.* en movimiento = in transit, on the go, moving.* gráfico en movimiento = animated graphic.* graficos en movimiento = animated media.* hacer un movimiento en falso = make + a false move.* horas de poco movimiento = slack hours.* imagen en movimiento = moving image, animated image.* imágenes en movimiento = animation.* libertad de movimiento = freedom of movement.* mantener las cosas en movimiento = keep + the ball rolling, keep + it rolling.* movimiento de fondo = groundswell.* movimiento de la población = population turnover, population transfer.* movimiento de libros = bookshift.* movimiento de personal = staff turnover, turnover, labour turnover.* movimiento de tierra = earthwork.* movimiento en falso = false move.* movimiento oscilante = rocking motion.* movimiento peatonal = foot traffic.* movimientos de efectivos = cash flow.* poner las cosas en movimiento = get + the ball rolling, set + the ball rolling, start + the ball rolling, get + things rolling, get + things going, set + the wheels in motion.* razones del movimiento de personal = turnover behaviour.* reconocedor del movimiento de los ojos = eye tracker.* ritmo de movimiento de mercancías = turnover rate.* ritmo de movimiento de personal = turnover rate.* sin movimiento = unmoving, motionless.* tasa de movimiento de mercancías = turnover rate.* tasa de movimiento de personal = turnover rate.* tecla de control del movimiento horizontal = horizontal positioning key.* tecla de control del movimiento vertical = vertical positioning key.movimiento22 = drive, tide, push, movement.Ex: Hierarchical bibliometry would act as a positive drive to support the authorship requirements now stipulated by some international editorial committees.
Ex: What has happened is that yet another institution has so overlapped with our own that we are being swept along on the tide of the technological revolution.Ex: The key issue to note here is that the global push to describe and document Indigenous knowledge is gaining momentum.Ex: The cathedral-like hush contrasted strangely with the clamor and movement outside.* movimiento artístico = art movement.* movimiento bibliotecario = library movement.* movimiento cultural = cultural movement.* movimiento de liberación nacional = national liberation movement.* movimiento de resistencia = resistance movement.* movimiento en defensa de los derechos de los animales = animal rights movement.* movimiento en defensa de los derechos de la mujer = women's rights movement.* movimiento feminista, el = women's movement, the.* movimiento político = political movement.* movimiento por los derechos civiles = civil rights movement.* movimiento scout, el = Scouts Movement, the.* * *Aun cuerpo en movimiento a body in motionesto pone el mecanismo en movimiento this sets the mechanism in motion¿cómo se mantiene en movimiento? how is it kept moving o in motion?cuando el vehículo está en movimiento when the vehicle is in motion o is movingse puso en movimiento it started movingel movimiento de las olas the movement o motion of the waves2 (desplazamiento) movementel número de movimientos que se registraron en el puerto the number of vessel movements in the port, the number of ships that entered or left the portel movimiento migratorio de las aves the migratory movement of birdsella está siempre en movimiento she's always on the go ( colloq)tenemos que ponernos en movimiento cuanto antes we have to get moving as soon as possibleel movimiento se demuestra andando actions speak louder than words3 (cambio de postura, posición) movementhizo un mal movimiento he turned ( o twisted etc) awkwardlyasintió con un vehemente movimiento de cabeza he nodded (his head) vigorouslyun movimiento en falso one false moveel menor movimiento de la mano the slightest movement of the handandaba con un ligero movimiento de caderas her hips swayed slightly as she walkedCompuestos:accelerationperpetual motionrotationorbital movementwave movement o motionperpetual motiondecelerationearth tremorearth tremorwave movement o motionB1 (traslado — de dinero, bienes) movement; (— de la población) shiftel libre movimiento de capitales/mercancías free movement of capital/goods2 (variación, cambio) movement, changehabrá poco movimiento en las temperaturas there will be little change in temperatureslos movimientos anómalos en los precios the unusual movements o changes in prices3 (agitación, actividad) activitysiempre hay mucho movimiento en el puerto there is always a great deal of activity in the portes una zona de mucho movimiento it's a bustling o a very busy areahubo poco movimiento ayer en la Bolsa there was little activity on the Stock Market yesterday, the Stock Market was quiet yesterdayC1 (corriente, tendencia) movementel movimiento surrealista/revolucionario the surrealist/revolutionary movementmovimiento literario literary movementmovimiento pictórico school of paintingmovimiento separatista/pacifista separatist/pacifist movementel movimiento de liberación femenina the women's liberation movement2 (organización) movementel movimiento pro amnistía the pro-amnesty movement3D (alzamiento) uprising, rebellionel día que saltó el movimiento the day the uprising o rebellion beganE ( Mús)1 (parte de una obra) movement2 (compás) tempoF ( Jueg) move* * *
movimiento sustantivo masculino
1
el movimiento surrealista the surrealist movement;
movimiento pictórico school of painting;
movimiento sísmico earth tremor
se puso en movimiento it started moving
2 (Mús) ( parte de obra) movement;
( compás) tempo
3 (Jueg) move
movimiento sustantivo masculino
1 movement
Fís Téc motion
2 (actividad) activity
3 Com Fin (de una cuenta) operations
4 (alzamiento, manifestación social) movement
el movimiento feminista, the feminist movement
5 Mús (de una composición) movement
' movimiento' also found in these entries:
Spanish:
abajo
- ademán
- animación
- bloquear
- delante
- desplazamiento
- detenida
- detenido
- ejercicio
- en
- entre
- febril
- gestarse
- gravitatoria
- gravitatorio
- inerte
- inmovilizar
- intranquila
- intranquilo
- obrera
- obrero
- oscilación
- pendular
- quieta
- quieto
- refleja
- reflejo
- retroceso
- revigorizar
- sacudida
- sandinista
- suelta
- suelto
- tic
- trabar
- traslación
- vaivén
- vanguardista
- ver
- veloz
- viaje
- adelante
- adentro
- adherir
- afuera
- ágil
- arriba
- ascendente
- avance
- brusco
English:
along
- anywhere
- approach
- astir
- away
- backward
- bandwagon
- bob
- bump
- by
- check
- dive
- dodge
- double-jointed
- down
- flap
- flick
- flow
- forward
- gesture
- in
- indoors
- into
- jerk
- laboured
- liberation
- measured
- motion
- move
- movement
- off
- on
- over
- past
- perpetual
- perpetual motion
- poof
- pro-life
- set
- sharp
- sideways
- smooth
- speed
- stamp
- sudden
- turnover
- uncontrollable
- underground
- way
- women's lib
* * *movimiento nm1. [desplazamiento, traslado] movement;hizo un movimiento con la mano she made a movement with her hand;asintió con un movimiento de la cabeza he nodded in agreement;seguía con la mirada todos mis movimientos he was watching my every move;¡no hagas ningún movimiento! don't move!;si haces un movimiento en falso, disparo if you move, I'll shoot, one false move and I'll shoot;la escayola entorpecía sus movimientos the plaster cast meant she couldn't move freely;hay pocos movimientos en la clasificación general there have been few changes in the overall standingsmovimiento migratorio migratory movement; Med movimientos oculares rápidos rapid eye movement;movimientos de población population shifts;movimiento sísmico earth tremor2. [en física y mecánica] motion;en movimiento moving, in motion;se bajó del tren cuando todavía estaba en movimiento she got off the train while it was still moving;poner algo en movimiento to set sth in motion;ponerse en movimiento to start movingFís movimiento acelerado accelerated motion; Fís movimiento continuo perpetual motion; Fís movimiento ondulatorio wave motion; Fís movimiento oscilatorio oscillatory motion; Fís movimiento de rotación rotational motion; Fís movimiento de traslación orbital motion; Fís movimiento uniforme motion at a constant velocity3. [corriente ideológica, artística] movement;el movimiento dadaísta the Dadaist movement;el movimiento obrero the working-class movement;el movimiento pacifista the peace movement4. Histel Movimiento (Nacional) [en España] = organisation uniting all Fascist groups supporting Franco, founded on 19th April 1937, and which served as the official party of his regime until 19755.movimiento (militar) [sublevación] (military) uprising6. [actividad] activity;[de vehículos] traffic; [de personal, mercancías] turnover; [en cuenta bancaria] transaction; [en contabilidad] operation;últimos movimientos [opción en cajero automático] print mini-statementmovimiento de capitales capital movements9. [en ajedrez, damas, juego de mesa] move10. [alzamiento] uprising* * *m1 movement2 COM, figactivity* * *movimiento nm: movement, motionmovimiento del cuerpo: bodily movementmovimiento sindicalista: labor movement* * *1. (en general) movement2. (marcha) motion -
7 animado
adj.1 animate, animated, moved, bustling.2 busy.3 alive, living.past part.past participle of spanish verb: animar.* * *1→ link=animar animar► adjetivo1 (movido) animated, lively, jolly2 (concurrido) bustling, full of people3 (alegre) cheerful, in high spirits, excited* * *(f. - animada)adj.cheerful, alive* * *ADJ1) (=con ánimo)2) (=alentado)animado de o por algo/algn — encouraged by sth/sb, urged on by sth/sb
animados por los hinchas — encouraged o urged on by the fans
3) [lugar] (=alegre) lively; (=concurrido) [bar, mercado] bustling, busy4) (=con vida) animatedibujo 2)5) (Ling) animate* * *- da adjetivo1)a) <fiesta/ambiente> lively; <conversación/discusión> lively, animatedb) (optimista, con ánimo) cheerful, in good spirits2) ( impulsado)animado de or por algo — inspired o motivated by something
* * *= lively [livelier -comp., liveliest -sup.], vibrant, animate, animated, perky [perkier -comp., perkiest -sup.].Ex. But in the country the processes of printing always provoke such lively curiosity that the customers preferred to go in by a glazed door set in the shop-front and giving onto the street.Ex. All these issues were successfully addressed by rearranging study, reference, and stack areas and enclosing a small office to create a more vibrant, reference oriented library environment.Ex. This article reports the results of a study to determine the decision making processes used by doctors when examining medical information derived from animate information sources, such as: colleagues; consultants; and medical information centres.Ex. His manner was more animated, but not in the usual petulant sense: he even seemed years younger.Ex. The members of Harvey's family seem almost spookily healthy and perky and nice to each other.----* de un modo animado = perkily.* dibujos animados = animated cartoons.* dibujos animados japoneses = Anime.* gráfico animado = motion graphic.* película de dibujos animados = cartoon film.* * *- da adjetivo1)a) <fiesta/ambiente> lively; <conversación/discusión> lively, animatedb) (optimista, con ánimo) cheerful, in good spirits2) ( impulsado)animado de or por algo — inspired o motivated by something
* * *= lively [livelier -comp., liveliest -sup.], vibrant, animate, animated, perky [perkier -comp., perkiest -sup.].Ex: But in the country the processes of printing always provoke such lively curiosity that the customers preferred to go in by a glazed door set in the shop-front and giving onto the street.
Ex: All these issues were successfully addressed by rearranging study, reference, and stack areas and enclosing a small office to create a more vibrant, reference oriented library environment.Ex: This article reports the results of a study to determine the decision making processes used by doctors when examining medical information derived from animate information sources, such as: colleagues; consultants; and medical information centres.Ex: His manner was more animated, but not in the usual petulant sense: he even seemed years younger.Ex: The members of Harvey's family seem almost spookily healthy and perky and nice to each other.* de un modo animado = perkily.* dibujos animados = animated cartoons.* dibujos animados japoneses = Anime.* gráfico animado = motion graphic.* película de dibujos animados = cartoon film.* * *animado -daA1 ‹fiesta/reunión/ambiente› lively; ‹conversación/discusión› lively, animated2 (optimista, con ánimo) cheerful, in good spiritshoy está más animado he's more cheerful o he's in better spirits todayanimado A + INF:estoy más animado a intentarlo ahora I feel more like trying o more up to trying nowB (impulsado) animado DE or POR algo inspired o motivated BY sthun movimiento animado de excelentes principios a movement inspired o motivated by excellent principlesactuó animado de impecables propósitos he acted with the best of intentions* * *
Del verbo animar: ( conjugate animar)
animado es:
el participio
Multiple Entries:
animado
animar
animado◊ -da adjetivo
1
‹conversación/discusión› lively, animated
2 ( impulsado) animado de or por algo inspired o motivated by sth
animar ( conjugate animar) verbo transitivo
1
( levantar el espíritu) to cheer … up;
animado a algn a hacer algo or a que haga algo to encourage sb to do sth
2 ‹ programa› to present, host
3 ( impulsar) to inspire
animarse verbo pronominal
[ persona] to liven up
◊ si me animo a salir te llamo if I feel like going out, I'll call youc) ( atreverse):◊ ¿quién se anima a decírselo? who's going to be brave enough to tell him?;
no me animo a saltar I can't bring myself to jump;
al final me animé a confesárselo I finally plucked up the courage to tell her
animado,-a adjetivo
1 (fiesta, reunión, conversación) lively
2 (estado de ánimo) cheerful
animar verbo transitivo
1 (alegrar a alguien) to cheer up
(una fiesta, una reunión) to liven up, brighten up
2 (estimular a una persona) to encourage
' animado' also found in these entries:
Spanish:
animada
- alborotado
- mono
- vivo
English:
animated
- busy
- chirpy
- lively
- perky
- sprightly
- subdued
- swing
- zestful
- bustling
- racy
- spirit
* * *animado, -a adj1. [con buen ánimo] cheerful;se encuentra muy animado después de la operación he's in excellent spirits after the operation2. [entretenido] lively;fue un partido muy animado it was a very lively match3. [con alma] animate, living;los objetos animados e inanimados animate and inanimate objects4. Cine animated;* * *adj lively* * *animado, -da adj1) : animated, lively2) : cheerful♦ animadamente adv* * *animado adj1. (persona) cheerful -
8 vivo
adj.1 live, alive, living, above-ground.2 lively, keen, alert, brisk.3 bright, shining, vivid.4 alive, passionate.f. & m.living person.pres.indicat.1st person singular (yo) present indicative of spanish verb: vivir.* * *► adjetivo1 (que tiene vida) living; (que está) alive2 (fuego, llama) live, burning3 (lengua) living4 figurado (color etc) bright, vivid6 figurado (dolor, emoción, etc) acute, deep, intense7 figurado (descripción etc) lively, graphic8 figurado (carácter) quick, irritable11 figurado (llaga, herida) open► nombre masculino,nombre femenino1 living person1 COSTURA trimming, border\a lo vivo vividlyde viva voz verbally, by word of mouthen carne viva raw, red raw 2 figurado freshen vivo TELEVISIÓN liveal rojo vivo red-hotherir a alguien en lo más vivo / tocar a alguien en lo más vivo figurado to cut somebody to the quick¿quién vive? MILITAR who goes there?ser el vivo retrato de / ser la viva imagen de familiar to be the spitting image oftener el genio vivo to be quick-temperedfuerzas vivas figurado driving forces————————1 COSTURA trimming, border* * *(f. - viva)adj.1) alive2) lively3) vivid* * *vivo, -a1. ADJ1) (=con vida)se busca vivo o muerto — wanted, dead or alive
b) [piel] rawme dio o hirió en lo más vivo — it cut me to the quick
cal, fuerza 5), lágrima, lengua 4)a lo vivo —
2) (TV, Radio)en vivo — (=en directo) live; (=en persona) in person
un espectáculo con música en vivo — a live music show, a show with live music
¿has visto en vivo a algún famoso? — have you ever seen anyone famous in the flesh?
3) (=intenso) [descripción] vivid, graphic; [imaginación, mirada, ritmo] lively; [movimiento, paso] quick, lively; [color] bright; [sensación] acute; [genio] fiery; [ingenio] ready; [inteligencia] sharp, keen; [filo] sharprojo 2., 1), voz 1)su recuerdo siempre seguirá vivo entre nosotros — her memory will always be with us, her memory will live on in our minds
4) [persona] (=listo) clever; (=astuto) sharp; (=animado) lively2. SM/ F1) *(=aprovechado)es un vivo — he's a clever one *, he's a sly one *
2)3.SM (Cos) edging, border* * *I- va adjetivo1)a) ( con vida) alivea lo vivo — (fam) without anesthetic*
en vivo — <actuación/transmisión> live
b) < lengua> living (before n)2)a) < persona> (despierto, animado) vivacious, bubbly; < descripción> vivid, graphic; <relato/imaginación> livelyb) < color> bright, vivid; <llama/fuego> bright; <ojos/mirada> lively, brightc) <sentimiento/deseo> intense, strongen lo más vivo: me hirió en lo más vivo he cut me to the quick; me afectó en lo más vivo — it affected me very deeply
3) (avispado, astuto) sharpIIno seas tan vivo — don't try to be clever
* * *= alive, live, living, vivid, quickened, vibrant + Color, bright [brighter -comp., brightest -sup.], living and breathing, surviving, walking, land of the living, the, spry [spryer comp., spryest -sup.], sprightly [sprightlier -comp., sprightliest -sup.], shrewd [shrewder -comp., shrewdest -sup.].Ex. Armstrong Sperry's 'Call It Courage' is now some years old but still to my mind an attractive and alive book.Ex. By designing the floors to carry a superimposed live load of 6.5 kN/m2, it is easy to move bookshelves, reader places and other library functions to any part of the building.Ex. Few librarians have had both his dedication and ability to make the catalog a living tool serving all of the people.Ex. There are vivid examples of serious fires and other natural disasters occuring in libraries that cause incalculable financial and academic losses to society.Ex. For a storyteller preparation is like rehearsal for an orchestra; there will be passages that need emphasis, and some that need a slow pace, others that need a quickened tempo, and so on = La preparación de un narrador de cuentos es como el ensayo de una orquesta; habrá pasajes que necesiten énfasis, otros un ritmo lento, otros un ritmo acelerado, etcétera.Ex. The store was gutted and rebuilt, according to his specifications, into a beautiful, modern facility, decorated in vibrant hues and furnished with the latest Herman Miller offerings.Ex. The openness of the now accessible stacks is emphasised by use of glass and bright colours.Ex. They are more than simple documents -- they are living and breathing expressions of important ethical concerns.Ex. Interviews were with a surviving next of kin or a nonrelative about three months after the event of death.Ex. He is a walking history of modern librarianship and has been a mentor to many.Ex. This is a review article on a book by Stephen M. Borish ' The Land of the Living'.Ex. A spry 80 years young, Virginia has been painting murals for the last 50 years and a lot can be said for the advantages of experience.Ex. He was described as a ' sprightly nonagenarian' who was born in 1905.Ex. Payment is very important and can be a problem so the businessman needs to be streetwise and shrewd with a good business acumen.----* actuación en vivo = live performance, live entertainment.* apagar la cal viva = slake + quicklime.* a viva voz = open outcry.* cal viva = quicklime.* comerse Algo vivo, devorarse Algo = eat + Nombre + alive.* concierto en vivo = live concert.* continuar vivo = live on.* cosa viva = living thing.* de viva voz = orally, word-of-mouth, by word of mouth.* el muerto al hoyo y el vivo al bollo = dead men have no friends.* entre los vivos = land of the living, the.* en vivo = live-action, in vivo, live.* imaginación muy viva = vivid imagination.* leyenda vivida = living legend.* llorar a lágrima viva = sob + Posesivo + heart out, cry + Posesivo + heart out, cry + uncontrollably.* mantener Algo vivo = keep + the flame alive, keep + Nombre + at the fore.* mantener vivo = keep + alive, keep + Nombre + going.* materia viva = living matter.* monumento vivo = living monument.* música en vivo = live music.* no vivo = nonliving [non-living].* organismo vivo = living thing.* permanecer vivo = remain + alive.* ponerse al rojo vivo = reach + boiling point, fire up.* publicación seriada viva = active serial.* revista viva = active journal.* rojo vivo = vibrant red, vermilion [vermillion].* seguir vivo = live on, stay + alive.* sentirse vivo = feel + alive.* ser un vivo retrato de = be a dead ringer for.* servicio de referencia en vivo = live reference.* ser vivo = sentient being.* tener algo muy vivo en la mente de uno = be strong in + mind.* viva + Nombre = long live + Nombre.* vivos, los = living, the.* * *I- va adjetivo1)a) ( con vida) alivea lo vivo — (fam) without anesthetic*
en vivo — <actuación/transmisión> live
b) < lengua> living (before n)2)a) < persona> (despierto, animado) vivacious, bubbly; < descripción> vivid, graphic; <relato/imaginación> livelyb) < color> bright, vivid; <llama/fuego> bright; <ojos/mirada> lively, brightc) <sentimiento/deseo> intense, strongen lo más vivo: me hirió en lo más vivo he cut me to the quick; me afectó en lo más vivo — it affected me very deeply
3) (avispado, astuto) sharpIIno seas tan vivo — don't try to be clever
* * *= alive, live, living, vivid, quickened, vibrant + Color, bright [brighter -comp., brightest -sup.], living and breathing, surviving, walking, land of the living, the, spry [spryer comp., spryest -sup.], sprightly [sprightlier -comp., sprightliest -sup.], shrewd [shrewder -comp., shrewdest -sup.].Ex: Armstrong Sperry's 'Call It Courage' is now some years old but still to my mind an attractive and alive book.
Ex: By designing the floors to carry a superimposed live load of 6.5 kN/m2, it is easy to move bookshelves, reader places and other library functions to any part of the building.Ex: Few librarians have had both his dedication and ability to make the catalog a living tool serving all of the people.Ex: There are vivid examples of serious fires and other natural disasters occuring in libraries that cause incalculable financial and academic losses to society.Ex: For a storyteller preparation is like rehearsal for an orchestra; there will be passages that need emphasis, and some that need a slow pace, others that need a quickened tempo, and so on = La preparación de un narrador de cuentos es como el ensayo de una orquesta; habrá pasajes que necesiten énfasis, otros un ritmo lento, otros un ritmo acelerado, etcétera.Ex: The store was gutted and rebuilt, according to his specifications, into a beautiful, modern facility, decorated in vibrant hues and furnished with the latest Herman Miller offerings.Ex: The openness of the now accessible stacks is emphasised by use of glass and bright colours.Ex: They are more than simple documents -- they are living and breathing expressions of important ethical concerns.Ex: Interviews were with a surviving next of kin or a nonrelative about three months after the event of death.Ex: He is a walking history of modern librarianship and has been a mentor to many.Ex: This is a review article on a book by Stephen M. Borish ' The Land of the Living'.Ex: A spry 80 years young, Virginia has been painting murals for the last 50 years and a lot can be said for the advantages of experience.Ex: He was described as a ' sprightly nonagenarian' who was born in 1905.Ex: Payment is very important and can be a problem so the businessman needs to be streetwise and shrewd with a good business acumen.* actuación en vivo = live performance, live entertainment.* apagar la cal viva = slake + quicklime.* a viva voz = open outcry.* cal viva = quicklime.* comerse Algo vivo, devorarse Algo = eat + Nombre + alive.* concierto en vivo = live concert.* continuar vivo = live on.* cosa viva = living thing.* de viva voz = orally, word-of-mouth, by word of mouth.* el muerto al hoyo y el vivo al bollo = dead men have no friends.* entre los vivos = land of the living, the.* en vivo = live-action, in vivo, live.* imaginación muy viva = vivid imagination.* leyenda vivida = living legend.* llorar a lágrima viva = sob + Posesivo + heart out, cry + Posesivo + heart out, cry + uncontrollably.* mantener Algo vivo = keep + the flame alive, keep + Nombre + at the fore.* mantener vivo = keep + alive, keep + Nombre + going.* materia viva = living matter.* monumento vivo = living monument.* música en vivo = live music.* no vivo = nonliving [non-living].* organismo vivo = living thing.* permanecer vivo = remain + alive.* ponerse al rojo vivo = reach + boiling point, fire up.* publicación seriada viva = active serial.* revista viva = active journal.* rojo vivo = vibrant red, vermilion [vermillion].* seguir vivo = live on, stay + alive.* sentirse vivo = feel + alive.* ser un vivo retrato de = be a dead ringer for.* servicio de referencia en vivo = live reference.* ser vivo = sentient being.* tener algo muy vivo en la mente de uno = be strong in + mind.* viva + Nombre = long live + Nombre.* vivos, los = living, the.* * *A1 (con vida) alive[ S ] se busca vivo o muerto wanted, dead or alivelos mosquitos me están comiendo vivo ( fam); I'm being eaten alive by mosquitoesno vimos ninguna serpiente viva we didn't see any live snakeses ya una leyenda viva he is a legend in his own lifetime, he is a living legendmantuvo viva su fé she kept her faith aliveen vivo livemúsica en vivo live musichicieron el programa en vivo they did the program live2 ‹lengua› living ( before n)el idioma sigue vivo the language is still aliveB1 ‹persona› (despierto, animado) vivacious, bubbly2 ‹descripción› vivid, graphic; ‹relato/imaginación› livelyaún tengo vivo en la memoria aquel momento I can still remember that moment vividly4 ‹ojos/mirada› lively, bright5 ‹sentimiento/deseo› intense, stronglo más vivo: sus palabras me llegaron a lo más vivo her words cut me to the quicksu muerte me afectó en lo más vivo his death affected me very deeplyC (avispado, astuto) sharpése es muy vivo y no se va a dejar engañar that guy is too smart o sharp to be taken in ( colloq)no seas tan vivo, que ésta es mi parte don't try to be clever o to pull a fast one, this is my share ( colloq)esos vendedores son muy vivos those salesmen are razor-sharp ( colloq)masculine, feminine( fam)1 (oportunista) sharp o smooth operator ( colloq)2 (aprovechado) crafty devil ( colloq)* * *
Del verbo vivir: ( conjugate vivir)
vivo es:
1ª persona singular (yo) presente indicativo
Multiple Entries:
vivir
vivo
vivir ( conjugate vivir) verbo intransitivo
1 ( en general) to live;◊ vive solo he lives alone o on his own;
vivo para algo/algn to live for sth/sb;
vivo en paz to live in peace;
la pintura no da para vivo you can't make a living from painting;
el sueldo no le alcanza para vivo his salary isn't enough (for him) to live on;
vivo de algo ‹ de la caridad› to live on sth;
‹del arte/de la pesca› to make a living from sth;
ver tb◊ renta
2 ( estar vivo) to be alive
3 ( como interj):◊ ¡viva el Rey! long live the King!;
¡vivan los novios! three cheers for the bride and groom!;
¡viva! hurray!
verbo transitivoa) ( pasar por):
los que vivimos la guerra those of us who lived through the war
vivo◊ -va adjetivo
1
en vivo ‹actuación/transmisión› live
2
‹ descripción› vivid, graphic;
‹relato/imaginación› lively
‹llama/fuego› bright;
‹ojos/mirada› lively, bright
3 (avispado, astuto) sharp;◊ no seas tan vivo don't try to be clever
■ sustantivo masculino, femenino ( oportunista) sharp o smooth operator (colloq);
( aprovechado) freeloader
vivir
I verbo intransitivo
1 (tener vida) to live: vivió ochenta años, she lived to be eighty
¡aún vive!, he's still alive!
2 (estar residiendo) to live: viven en Australia, they live in Australia
3 (en la memoria) su recuerdo aún vive en nosotros, our memories of him still live on
4 (subsistir) no es suficiente para vivir, it's not enough to live on
esa gente vive de la caza, those people live from o by hunting
5 (convivir) viven juntos desde hace muchos años, they've been living together for years
II vtr (pasar una experiencia) to live through
III sustantivo masculino
1 life, living
2 (una persona) de mal vivir, loose, disreputable
♦ Locuciones: dejar vivir a alguien, (no molestar) vive y deja vivir, live and let live; familiar no vivir alguien, (preocupación, angustia) desde que tiene esa grave enfermedad, sus padres no viven, his parents have been in a state of anxiety since he's had this serious illness; familiar vivir la vida alguien, (libertad, ociosidad) ha acabado la carrera y ahora se dedica a vivir la vida, now he's finished his university studies he's going to enjoy life
vivo,-a
I adjetivo
1 alive: todavía está vivo, he's still alive
(un espectáculo) en vivo, live ➣ Ver nota en alive 2 (persona: vital, alegre) vivacious
(astuta) sharp
3 (intenso, brillante) bright
una camisa de un rojo vivo, a bright red shirt
4 (un relato, descripción) lively, graphic
(un sentimiento) intense, deep
II sustantivo masculino y femenino (persona avispada, astuta) sharp
♦ Locuciones: al rojo vivo, red-hot
familiar vivito y coleando, alive and kicking
' vivo' also found in these entries:
Spanish:
actualmente
- alegre
- alta
- alto
- ardiente
- criatura
- despierta
- despierto
- emisión
- ser
- estrangular
- extremidad
- fogón
- macho
- mantener
- prodigio
- retrato
- revivir
- roja
- rojo
- salud
- subsistir
- viva
- crecer
- espabilado
- inquieto
- listo
- paseo
- posibilidad
- punta
- que
- vivir
English:
active
- actually
- alive
- alone
- animate
- animated
- bright
- brighten up
- dad
- daddy
- deep
- develop
- eat
- fur
- hot up
- image
- keen
- live
- lively
- living
- midway
- near
- on
- out
- quicktempered
- red-hot
- rich
- solid
- spit
- still
- up
- vivid
- beyond
- concert
- glow
- hedge
- hedgerow
- home
- longing
- memory
- pull
- quick
- red
- sear
- survive
* * *vivo, -a♦ adj1. [ser, lengua] living2. [tras verbo] alive;estar vivo [persona, costumbre, recuerdo] to be alive;su recuerdo sigue vivo entre los suyos his memory lives on among his family;quemar vivo alguien to burn sb alive3. [intenso] [dolor, deseo, olor] intense;[luz, color, tono] bright; [genio] quick, hot; [paso, ritmo] lively;un vivo interés por algo a lively interest in sth4. [con vitalidad] [gestos, ojos] lively;[descripción, recuerdo] vivid;es el vivo retrato de su padre he's the spitting image of his father5. [despierto] quick, sharp;[astuto] shrewd, sly♦ los vivos nmplthe living♦ en vivo loc adj[en directo] live; [sin anestesia] without anaesthetic;haremos el programa en vivo we will do the programme live* * *I adj1 alive;los seres vivo living things;2 fig famsharp, smart3 color bright4 ritmo livelyII m, viva f sharp operator* * *vivo, -va adj1) : alive2) intenso: vivid, bright, intense3) animado: lively, vivacious4) astuto: sharp, clever5)en vivo : livetransmisión en vivo: live broadcast6)al rojo vivo : red-hot* * *vivo adj1. (con vida) alive2. (intenso) bright -
9 gráfico fijo
(n.) = still graphicEx. Different media will be supported: text, still graphics, animated graphics, sound, still images, video images, etc.* * *(n.) = still graphicEx: Different media will be supported: text, still graphics, animated graphics, sound, still images, video images, etc.
-
10 imagen
f.1 image (figura).a imagen y semejanza de identical to, exactly the same asser la viva imagen de alguien to be the spitting image of somebody2 picture (television).imágenes de archivo library picturesimágenes del partido/de la catástrofe pictures of the game/the disaster3 image.los casos de corrupción han deteriorado la imagen del gobierno the corruption scandals have tainted the image of the governmenttener buena/mala imagen to have a good/bad imageimagen corporativa o de empresa corporate imageimagen de marca brand image4 statue (estatua).5 image (literature).* * *1 image2 TELEVISIÓN picture\ser la viva imagen de alguien to be the spitting image of somebody* * *noun f.* * *SF1) (Fot, Ópt) image; (=en foto, dibujo, TV) picturelas imágenes del accidente — the pictures o images of the accident
2) (=reflejo) reflectionle gustaba contemplar su imagen en el espejo — he liked looking at himself o at his reflection in the mirror
- a la imagen y semejanza de unoun campeonato a imagen y semejanza de los que se celebran en Francia — a championship of exactly the same kind as those held in France
es la viva imagen de la felicidad — she is happiness personified, she is the picture of happiness
3) (=representación mental) image, picturetenía otra imagen de ti — I had a different image o picture of you
4) (=aspecto) image5) (Rel) [de madera, pintura] image; [de piedra] statue6) (Literat) (=metáfora) image* * *1)a) (Fís, Ópt) image; (TV) picture, imageb) ( foto) picturec) ( en espejo) reflectiona su imagen y semejanza — in his/her own image
d) ( en la mente) picture2) (de político, cantante, país) image4) (Lit) image* * *2 = persona [personae, -pl.], image, record, stature, profile, street cred, street credibility.Ex. In his early years he consciously emulated both the painterly style and persona of the much-admired artist Drouais, who became something of a cult figure in early 19th c. Paris.Ex. As she tried to figure out how to change her and the library's image, she made some interesting observations.Ex. She urges a boycott of California as a library conference venue until the state improves its current record of the worst school library provision in the US.Ex. Merely having the materials available will not provide the desired boost to the library's stature unless the collection is exceptional.Ex. There is also a further dilemma concerning formats such as film and audio which have tended to receive a lower profile in the library world (too awkward, too cluttered with copyright restrictions, too technically instable).Ex. Barack Hussein Obama has lost a lot of street cred with the country as of late, but maybe not in his world.Ex. These robbers carry out their vicious attacks for 'kicks' and street credibility rather than cash, a chilling study reveals.----* adoptar una imagen = put on + image.* arruinar + Posesivo + imagen = ruin + Posesivo + style, cramp + Posesivo + style.* borrar una imagen = eradicate + image.* cambio de imagen = makeover [make-over].* creador de imagen = image maker.* crear una imagen = build + an image, create + image.* dar la imagen = give + the impression that.* dar una imagen = convey + image, present + picture, paint + a picture, present + an image, present + a picture.* dar una imagen de = give + an impression of.* difundir buena imagen de = earn + credit for.* difundir la imagen = spread + the good word, pass on + the good word.* estropear + Posesivo + imagen = ruin + Posesivo + style, cramp + Posesivo + style.* evocar una imagen de = conjure up + an image of, conjure up + a vision of.* imagen comercial = brand image.* imagen corporativa = corporate image.* imagen crediticia = credit standing.* imagen de la biblioteca = library's profile.* imagen de uno mismo = self-presentation, body image.* imagen pública = public image.* mejorar + Posesivo + imagen = raise + Posesivo + profile, smarten up + Posesivo + image, enhance + Posesivo + identity, enhance + Posesivo + image, buff up + Posesivo + image.* ofrecer una imagen = present + picture.* presentar una imagen = present + picture, paint + a picture, present + an image.* problema de imagen = image problem.* proyectar imagen = project + image.* ser la imagen de = be a picture of.* * *1)a) (Fís, Ópt) image; (TV) picture, imageb) ( foto) picturec) ( en espejo) reflectiona su imagen y semejanza — in his/her own image
d) ( en la mente) picture2) (de político, cantante, país) image4) (Lit) image* * *imagen11 = frame, image, picture, shot.Ex: The microfiche is a common form for catalogues and indexes, usually 208 or 270 frames per fiche, in a piece of film and with a reduction ratio of 42 or 48:1.
Ex: A motion picture is a length of film, with or without recorded sound, bearing a sequence of images that create the illusion of movement when projected in rapid succession.Ex: No pretence is made of their being either a balanced or complete picture of the article.Ex: Each video shot is logged using text descriptions, audio dialogue, and cinematic attributes.* almacenamiento de imágenes = image archiving, image storage.* archivo de imágenes = image archiving, picture file.* avance rápido de imágenes = fast motion.* banco de imágenes = image bank.* basado en imágenes gráficas = graphics-based.* basado en las imágenes = image intensive.* base de datos de imágenes = image database, image bank.* calidad de la imagen = picture quality.* capacidad de interpretar imágenes = visual literacy.* captura de imágenes = image capture, image capturing.* catalogación de imágenes = image cataloguing.* centrado en las imágenes = image intensive.* composición de imágenes = image setting.* congelación de la imagen = freeze-frame.* congelar una imagen = freeze + frame.* con imágenes en movimiento = animated.* con muchas imágenes = image intensive.* creación de imágenes digitales = digital imaging.* crear una imagen = summon up + image.* diagnóstico por imagen = diagnostic imaging.* digitalización de imágenes = electronic imaging.* digitalización electrónica de imágenes = electronic imaging.* digitalizador de imágenes = image scanner.* doble imagen = ghosting.* documento de imagen en movimiento = moving image document.* fichero de imágenes = graphic file, image file.* fijador de imágenes = image setter.* gestión de imágenes = imaging, image-handling, image management.* gestión de imágenes de documentos = document image management.* gestión de imágenes digitales = digital imaging, digital image management.* gestión de imágenes electrónicas = electronic image management.* gestión de imágenes por ordenador = computer imaging.* habilidad de interpretar imágenes = visual literacy.* imagen a imagen = shot by shot.* imagen animada = moving picture.* imagen del pasado = flashback [flash back].* imagen de pantalla = screen shot [screen-shot].* imagen de satélite = satellite image.* imagen de vídeo = video image.* imagen digital = digital image.* imagen digital de un documento = digital image document.* imagen digitalizada = facsimile image.* imagen distorsionada = distorted picture, distorted image.* imagen en color = colour image.* imagen en miniatura = thumbnail, thumbnail image.* imagen en movimiento = moving image, animated image.* imágenes = imaging, imagery, video data, image data.* imagen escaneada = paper image.* imágenes digitales = digital imagery.* imágenes en movimiento = animation.* imágenes por ordenador = computer graphics.* imágenes vía satélite = satellite imagery, satellite image data.* imágenes y sonidos = sights and sounds.* imagen fija = still, still image, still-picture, film still, movie still.* imagen fotográfica = photographic image.* imagen gráfica = graphic image.* imagen mental = mental picture.* imagen negativa = negative image.* imagen visual = visual image.* periodista reportero de imágenes = video journalist.* que contiene muchas imágenes = image intensive.* realce de imágenes = image-enhancement.* reconocimiento de imágenes = image recognition.* reconocimiento de imágenes por el ordenador = computer vision.* recuperación de imágenes = image retrieval.* recuperación de imágenes digitales = digital image retrieval.* recuperación de imágenes fotográficas = picture retrieval.* recuperación de imágenes por el contenido = content-based image retrieval.* reportero de imágenes = video journalist.* sistema basado en las imágenes = image-based system.* sistema de gestión de imágenes = imaging system, image-based system, image management system.* sistema de proceso de imágenes = imaging system.* sistema de recuperación de imágenes = image retrieval system.* sistema de tratamiento de imágenes = image processing system.* tecnología para la creación de imágenes digitales = digital imaging technology.* tratamiento de imágenes = image processing.* Tratamiento de Imágenes de Documentos (DIP) = Document Image Processing (DIP).* una imagen vale más que mil palabras = a picture is worth more than ten thousand words.* una imagen vale mil palabras = every picture tells a story.* vídeo de imágenes fijas = image video.* visor de imagen = view finder.* visualización de imágenes = image display.2 = persona [personae, -pl.], image, record, stature, profile, street cred, street credibility.Ex: In his early years he consciously emulated both the painterly style and persona of the much-admired artist Drouais, who became something of a cult figure in early 19th c. Paris.
Ex: As she tried to figure out how to change her and the library's image, she made some interesting observations.Ex: She urges a boycott of California as a library conference venue until the state improves its current record of the worst school library provision in the US.Ex: Merely having the materials available will not provide the desired boost to the library's stature unless the collection is exceptional.Ex: There is also a further dilemma concerning formats such as film and audio which have tended to receive a lower profile in the library world (too awkward, too cluttered with copyright restrictions, too technically instable).Ex: Barack Hussein Obama has lost a lot of street cred with the country as of late, but maybe not in his world.Ex: These robbers carry out their vicious attacks for 'kicks' and street credibility rather than cash, a chilling study reveals.* adoptar una imagen = put on + image.* arruinar + Posesivo + imagen = ruin + Posesivo + style, cramp + Posesivo + style.* borrar una imagen = eradicate + image.* cambio de imagen = makeover [make-over].* creador de imagen = image maker.* crear una imagen = build + an image, create + image.* dar la imagen = give + the impression that.* dar una imagen = convey + image, present + picture, paint + a picture, present + an image, present + a picture.* dar una imagen de = give + an impression of.* difundir buena imagen de = earn + credit for.* difundir la imagen = spread + the good word, pass on + the good word.* estropear + Posesivo + imagen = ruin + Posesivo + style, cramp + Posesivo + style.* evocar una imagen de = conjure up + an image of, conjure up + a vision of.* imagen comercial = brand image.* imagen corporativa = corporate image.* imagen crediticia = credit standing.* imagen de la biblioteca = library's profile.* imagen de uno mismo = self-presentation, body image.* imagen pública = public image.* mejorar + Posesivo + imagen = raise + Posesivo + profile, smarten up + Posesivo + image, enhance + Posesivo + identity, enhance + Posesivo + image, buff up + Posesivo + image.* ofrecer una imagen = present + picture.* presentar una imagen = present + picture, paint + a picture, present + an image.* problema de imagen = image problem.* proyectar imagen = project + image.* ser la imagen de = be a picture of.* * *Adale más brillo a la imagen turn up the brightness2 (foto) picture3 (en un espejo) reflectioncontemplaba su imagen en el agua he was contemplating his reflection in the waterel espejo le devolvió una imagen triste y envejecida he saw a sad, aging face looking back at him in the mirrora su imagen y semejanza: Dios creó al hombre a su imagen y semejanza God created man in his own imagelas ha educado a su imagen y semejanza she has brought them up to be just like herser la viva or misma imagen de algn/algo: es la misma imagen de su padre he's the spitting image of his father ( colloq), he's exactly like his fatheres la viva imagen del entusiasmo he's enthusiasm itself o enthusiasm personified4 (en la mente) picturesólo conservo una imagen muy borrosa de él I only have a very vague picture in my mind of him o a very vague memory of himtenía una imagen muy distinta del lugar I had a very different mental image o picture of the placetenía una imagen confusa de lo ocurrido his idea o memory of what had happened was confusedCompuestos:mirror imagevirtual imageB (de un político, cantante, país) imagequiere proyectar una imagen renovada she wants to project a new imagesu imagen se ha visto afectada por estas derrotas his image has suffered as a result of these defeatsD ( Lit) imagelas imágenes en su poesía the images o imagery in her poetry* * *
imagen sustantivo femenino
1a) (Fís, Ópt) image;
(TV) picture, image
◊ ser la viva imagen de algn to be the image of sb
2 (de político, cantante, país) image
imagen sustantivo femenino
1 image: es la viva imagen de su padre, he is the living image of his father
2 (efecto, impresión) image: ese fallo perjudicó la imagen de la empresa, the accident affected the company image
3 TV picture: vimos las imágenes del terremoto, we saw a television report on the earthquake
4 Rel Arte image, statue
' imagen' also found in these entries:
Spanish:
corresponderse
- definición
- definida
- definido
- deformar
- desvanecerse
- estampa
- lavado
- nitidez
- nublarse
- plástica
- plástico
- refleja
- reflejo
- registrar
- representación
- reproducir
- sugestiva
- sugestivo
- templete
- borrar
- borroso
- cambiar
- centrar
- claridad
- confuso
- fotografía
- impactante
- inversión
- invertido
- invertir
- múltiple
- nebuloso
- nítido
- reflejar
- reivindicar
- toma
English:
blank
- blur
- clear
- conjure
- illusion
- image
- lurid
- part
- picture
- project
- sharp
- valuable
- critically
- perception
- self
- zoom
* * *imagen nf1. [figura] image;su imagen se reflejaba en el agua she could see her reflection in the water;contemplaba su imagen en el espejo he was looking at his reflection in the mirror;su rostro era la pura imagen del sufrimiento her face was a picture of suffering;eran la imagen de la felicidad they were a picture of happiness;ser la viva imagen de alguien to be the spitting image of sb;a imagen y semejanza: Dios creó al hombre a su imagen y semejanza God created man in his own image;reconstruyeron el museo a imagen y semejanza del original they rebuilt the museum so that it looked just like the old one2. [en física] image;[televisiva] picture;las imágenes en movimiento the moving image;imágenes del partido/de la catástrofe pictures of the game/the disaster;una imagen vale más que mil palabras one picture is worth a thousand wordsimágenes de archivo archive o Br library pictures;imagen virtual virtual image3. [aspecto] image;necesitas un cambio de imagen you need a change of o a new image;tiene una imagen de intolerante she has the image of being an intolerant person;quieren proyectar una imagen positiva they want to project a positive image;tener buena/mala imagen to have a good/bad image;los casos de corrupción han deteriorado la imagen del gobierno the corruption scandals have tainted the image of the governmentimagen corporativa corporate identity;imagen de empresa corporate image;imagen de marca brand image;imagen pública public image4. [recuerdo] picture, image;guardo una imagen muy borrosa de mis abuelos I only have a very vague memory of my grandparents;tenía una imagen diferente del lugar I had a different picture o image of the place, I had pictured the place differentlyimagen mental mental image5. [estatua] statue6. [literaria] image;utiliza unas imágenes muy ricas she uses very rich imagery* * *f tb figimage;ser la viva imagen de be the spitting image of* * ** * *imagen n1. (en general) image2. (en televisión) picture -
11 imagen1
1 = frame, image, picture, shot.Ex. The microfiche is a common form for catalogues and indexes, usually 208 or 270 frames per fiche, in a piece of film and with a reduction ratio of 42 or 48:1.Ex. A motion picture is a length of film, with or without recorded sound, bearing a sequence of images that create the illusion of movement when projected in rapid succession.Ex. No pretence is made of their being either a balanced or complete picture of the article.Ex. Each video shot is logged using text descriptions, audio dialogue, and cinematic attributes.----* almacenamiento de imágenes = image archiving, image storage.* archivo de imágenes = image archiving, picture file.* avance rápido de imágenes = fast motion.* banco de imágenes = image bank.* basado en imágenes gráficas = graphics-based.* basado en las imágenes = image intensive.* base de datos de imágenes = image database, image bank.* calidad de la imagen = picture quality.* capacidad de interpretar imágenes = visual literacy.* captura de imágenes = image capture, image capturing.* catalogación de imágenes = image cataloguing.* centrado en las imágenes = image intensive.* composición de imágenes = image setting.* congelación de la imagen = freeze-frame.* congelar una imagen = freeze + frame.* con imágenes en movimiento = animated.* con muchas imágenes = image intensive.* creación de imágenes digitales = digital imaging.* crear una imagen = summon up + image.* diagnóstico por imagen = diagnostic imaging.* digitalización de imágenes = electronic imaging.* digitalización electrónica de imágenes = electronic imaging.* digitalizador de imágenes = image scanner.* doble imagen = ghosting.* documento de imagen en movimiento = moving image document.* fichero de imágenes = graphic file, image file.* fijador de imágenes = image setter.* gestión de imágenes = imaging, image-handling, image management.* gestión de imágenes de documentos = document image management.* gestión de imágenes digitales = digital imaging, digital image management.* gestión de imágenes electrónicas = electronic image management.* gestión de imágenes por ordenador = computer imaging.* habilidad de interpretar imágenes = visual literacy.* imagen a imagen = shot by shot.* imagen animada = moving picture.* imagen del pasado = flashback [flash back].* imagen de pantalla = screen shot [screen-shot].* imagen de satélite = satellite image.* imagen de vídeo = video image.* imagen digital = digital image.* imagen digital de un documento = digital image document.* imagen digitalizada = facsimile image.* imagen distorsionada = distorted picture, distorted image.* imagen en color = colour image.* imagen en miniatura = thumbnail, thumbnail image.* imagen en movimiento = moving image, animated image.* imágenes = imaging, imagery, video data, image data.* imagen escaneada = paper image.* imágenes digitales = digital imagery.* imágenes en movimiento = animation.* imágenes por ordenador = computer graphics.* imágenes vía satélite = satellite imagery, satellite image data.* imágenes y sonidos = sights and sounds.* imagen fija = still, still image, still-picture, film still, movie still.* imagen fotográfica = photographic image.* imagen gráfica = graphic image.* imagen mental = mental picture.* imagen negativa = negative image.* imagen visual = visual image.* periodista reportero de imágenes = video journalist.* que contiene muchas imágenes = image intensive.* realce de imágenes = image-enhancement.* reconocimiento de imágenes = image recognition.* reconocimiento de imágenes por el ordenador = computer vision.* recuperación de imágenes = image retrieval.* recuperación de imágenes digitales = digital image retrieval.* recuperación de imágenes fotográficas = picture retrieval.* recuperación de imágenes por el contenido = content-based image retrieval.* reportero de imágenes = video journalist.* sistema basado en las imágenes = image-based system.* sistema de gestión de imágenes = imaging system, image-based system, image management system.* sistema de proceso de imágenes = imaging system.* sistema de recuperación de imágenes = image retrieval system.* sistema de tratamiento de imágenes = image processing system.* tecnología para la creación de imágenes digitales = digital imaging technology.* tratamiento de imágenes = image processing.* Tratamiento de Imágenes de Documentos (DIP) = Document Image Processing (DIP).* una imagen vale más que mil palabras = a picture is worth more than ten thousand words.* una imagen vale mil palabras = every picture tells a story.* vídeo de imágenes fijas = image video.* visor de imagen = view finder.* visualización de imágenes = image display. -
12 vivo
Del verbo vivir: ( conjugate vivir) \ \
vivo es: \ \1ª persona singular (yo) presente indicativoMultiple Entries: vivir vivo
vivir ( conjugate vivir) verbo intransitivo 1 ( en general) to live;◊ vive solo he lives alone o on his own;vivo para algo/algn to live for sth/sb; vivo en paz to live in peace; la pintura no da para vivo you can't make a living from painting; el sueldo no le alcanza para vivo his salary isn't enough (for him) to live on; vivo de algo ‹ de la caridad› to live on sth; ‹del arte/de la pesca› to make a living from sth; ver tb◊ renta2 ( estar vivo) to be alive 3 ( como interj):◊ ¡viva el Rey! long live the King!;¡vivan los novios! three cheers for the bride and groom!; ¡viva! hurray! verbo transitivoa) ( pasar por):los que vivimos la guerra those of us who lived through the war
vivo
◊ -va adjetivo1 en vivo ‹ actuaciónansmisión› live 2 ‹ descripción› vivid, graphic; ‹relato/imaginación› lively ‹llama/fuego› bright; ‹ojos/mirada› lively, bright 3 (avispado, astuto) sharp;◊ no seas tan vivo don't try to be clever■ sustantivo masculino, femenino ( oportunista) sharp o smooth operator (colloq); ( aprovechado) freeloader
vivir
I verbo intransitivo
1 (tener vida) to live: vivió ochenta años, she lived to be eighty
¡aún vive!, he's still alive!
2 (estar residiendo) to live: viven en Australia, they live in Australia
3 (en la memoria) su recuerdo aún vive en nosotros, our memories of him still live on
4 (subsistir) no es suficiente para vivir, it's not enough to live on
esa gente vive de la caza, those people live from o by hunting
5 (convivir) viven juntos desde hace muchos años, they've been living together for years
II vtr (pasar una experiencia) to live through
III sustantivo masculino
1 life, living
2 (una persona) de mal vivir, loose, disreputable Locuciones: dejar vivir a alguien, (no molestar) vive y deja vivir, live and let live; familiar no vivir alguien, (preocupación, angustia) desde que tiene esa grave enfermedad, sus padres no viven, his parents have been in a state of anxiety since he's had this serious illness; familiar vivir la vida alguien, (libertad, ociosidad) ha acabado la carrera y ahora se dedica a vivir la vida, now he's finished his university studies he's going to enjoy life
vivo,-a
I adjetivo
1 alive: todavía está vivo, he's still alive (un espectáculo) en vivo, live ➣ Ver nota en alive 2 (persona: vital, alegre) vivacious (astuta) sharp
3 (intenso, brillante) bright
una camisa de un rojo vivo, a bright red shirt
4 (un relato, descripción) lively, graphic (un sentimiento) intense, deep
II sustantivo masculino y femenino (persona avispada, astuta) sharp Locuciones: al rojo vivo, red-hot familiar vivito y coleando, alive and kicking ' vivo' also found in these entries: Spanish: actualmente - alegre - alta - alto - ardiente - criatura - despierta - despierto - emisión - ser - estrangular - extremidad - fogón - macho - mantener - prodigio - retrato - revivir - roja - rojo - salud - subsistir - viva - crecer - espabilado - inquieto - listo - paseo - posibilidad - punta - que - vivir English: active - actually - alive - alone - animate - animated - bright - brighten up - dad - daddy - deep - develop - eat - fur - hot up - image - keen - live - lively - living - midway - near - on - out - quicktempered - red-hot - rich - solid - spit - still - up - vivid - beyond - concert - glow - hedge - hedgerow - home - longing - memory - pull - quick - red - sear - survive -
13 живой
1) living
2) (подвижный, деятельный)
lively, vivid, vivacious, animated, brisk* * ** * *living; live; alive* * *aliveanimatedbouncybreezybriskdashingfacetiousgraphichigh-colouredjocundlivelivelylivingnimblepoignantracysaucysinewyskittishsnappyspiritedvividyouthful -
14 vivid
1. a живой; пылкий; яркий2. a чёткий, ясныйСинонимический ряд:1. animated (adj.) animated; energetic; lively; spirited; vigorous; vigourous; vivacious2. brilliant (adj.) brilliant; glowing; lucid; lustrous; resplendent; shining3. colorful (adj.) brave; bright; colorful; colory; colourful; gay; intense; showy; vibrant4. distinct (adj.) apparent; clear; definite; discernible; distinct; perceptible; striking; strong5. realistic (adj.) colourful; graphic; lifelike; photographic; pictorial; picturesque; realisticАнтонимический ряд:dim; drab; dull; dusky; lifeless; nebulous; obscure; opaque; slow; sombre; tame; vague; weak -
15 display
1) визуальное воспроизведение, визуальное представление; отображение ( информации); индикация || воспроизводить; отображать2) изображение || изображать3) воспроизводящее устройство; видеотерминал; устройство отображения ( информации), дисплей; индикатор, индикаторное устройство; транспарант; табло4) показ, демонстрация || выставлять, показывать5) витрина; рекламная стойка6) выделение особым шрифтом || выделять особым шрифтом7) полигр. акцидентная продукция•control and display — 1. управление и индикация 2. пульт управления и индикации;to manipulate displays in real-time — манипулировать изображением в реальном (масштабе) времени-
active display
-
addressable display
-
airborne display
-
all-digital display
-
alphanumeric display
-
alphameric display
-
animated display
-
axis position display
-
beam-addressed display
-
bimodal display
-
bit-mapped display
-
bit-map display
-
black-and-white display
-
boxed display
-
call display
-
calligraphic display
-
cathode-luminescent display
-
cathode-ray tube display
-
channel display
-
character display
-
cockpit display
-
color display
-
command and control display
-
compensatory tracking display
-
composite display
-
computed display
-
computer display
-
control code display
-
CRT display
-
dark trance display
-
data display
-
deflection-modulated display
-
density altitude display
-
dial display
-
digital data display
-
digital display
-
direct display
-
direct driven display
-
directed-beam display
-
Doppler-range display
-
dot/bar display
-
dot-matrix display
-
dynamic display
-
electrochromic display
-
electroluminescent display
-
electronic display
-
electronic typewriter display
-
electrooptic display
-
electrophoretic image display
-
electrophoretic display
-
eye display
-
faceplate display
-
fault display
-
ferroelectric ceramic display
-
ferroelectric display
-
flat panel display
-
flicker-free display
-
flight information display
-
flight progress display
-
fluorescent display
-
full page display
-
gas discharge display
-
gas panel display
-
gas plasma display
-
graphical display
-
graphic display
-
great display
-
group display
-
half-page display
-
hard copy display
-
head-up projection display
-
head-up display
-
helmet-mounted display
-
helmet display
-
high-density display
-
holographic display
-
horizontal scroll display
-
image display
-
incremental display
-
index display
-
in-line display
-
in-picture display
-
integrated display
-
intelligent display
-
intensity-modulated display
-
interactive display
-
keyboard display
-
kinesthetic-tactual display
-
lamp display
-
landscape display
-
laser-beam display
-
laser display
-
legible display
-
light display
-
light valve display
-
light-emitting diode display
-
linearly deformed display
-
line-drawing display
-
liquid-crystal display
-
magnetic particles display
-
makeup display
-
matrix display
-
matrix-addressed display
-
mechanically refrigerated display
-
memory-mapped display
-
message display
-
meter display
-
mirror display
-
mixed display
-
monitor display
-
monochrome display
-
multicolor display
-
multipage display
-
navigation display
-
n-bit display
-
n-character display
-
nonflickering display
-
numeric display
-
on-screen display
-
oscilloscope display
-
overlay display
-
panel display
-
panoramic display
-
passive display
-
pictorial display
-
piezoelectric display
-
pip-matching display
-
plasma-discharge display
-
plasma display
-
plotting projection display
-
portrait display
-
process status display
-
projected display
-
projection display
-
radar display
-
radially deformed display
-
random-point display
-
random display
-
range-altitude display
-
range-azimuth display
-
range-height display
-
raster display
-
raster scan display
-
rectangular coordinate display
-
reflective-mode display
-
reflective display
-
refrigerated display
-
remote display
-
remote viewing display
-
scan-converted radar display
-
scanned display
-
scroll display
-
sector display
-
segment display
-
self-contained refrigerated display
-
self-cycling display
-
self-shift plasma display
-
side destination display
-
signal display
-
specular display
-
state display
-
stereo display
-
storage display
-
superimposed panoramic radar display
-
tabular display
-
television display
-
textual display
-
text display
-
thin window display
-
three-dimensional display
-
three-dimension display
-
time-height display
-
touch-sensitive display
-
touch display
-
two-dimensional display
-
two-dimension display
-
undeformed display
-
vacuum fluorescent display
-
variable-area display
-
variable-density display
-
vector display
-
velocity-azimuth display
-
vertical scroll display
-
video display
-
visible display
-
visual display
-
wall-board display
-
wall display
-
wiggle-line display
-
wiggle display
-
windshield display
-
X-Y matrix display -
16 film
1) плёнка, тонкий слой || покрываться плёнкой2) оболочка; покрытие4) (фото)плёнка5) киноплёнка; кинолента6) (кино)фильм; фильмокопия || производить киносъёмку; снимать на киноплёнку7) геофиз. диаграмма (сейсмограмма), записанная на фотоплёнке•film perforated (along) one edge — киноплёнка с односторонней перфорацией;to run through the film — просматривать фильм;to thread the film — заряжать киноплёнку-
acetate film
-
adhesive film
-
adsorbed film
-
advertising film
-
aerial film
-
air bubble film
-
air film
-
aligning film
-
amateur film
-
amorphous film
-
animated film
-
anodized film
-
antifogging film
-
antihalation film
-
antireflection film
-
autopositive film
-
axially oriented film
-
balanced film
-
base film
-
biaxially-oriented film
-
bimetallized film
-
black-and-white film
-
blank film
-
blown film
-
blue diazo assembly film
-
boundary film
-
bubble film
-
bubble-free film
-
burnished film
-
calendered film
-
carrying film
-
cartoon film
-
cast film
-
center fold film
-
cinema film
-
cine film
-
clearbase film
-
cling film
-
coarse-grain film
-
color film
-
commercial film
-
composite film
-
conducting film
-
contact film
-
continuous film
-
continuous lubricating film
-
continuous tone film
-
convergent lubricant film
-
convergent film
-
cooling film
-
cryovac film
-
crystalline film
-
cut film
-
diazo-type film
-
diazo film
-
dichromated gelatine film
-
dichromated gelatin film
-
dielectric film
-
discontinuous film
-
distillation film
-
doped film
-
double-coated film
-
drafting film
-
dry process film
-
dry silver film
-
dubbed film
-
duplicating film
-
dye-degraded library film
-
educational film
-
elastohydrodynamic lubrication film
-
electrodeposited film
-
electron-beam evaporated film
-
endless type film
-
epitaxial film
-
evaporated film
-
exposed film
-
faded film
-
fast film
-
feature film
-
ferroelectric film
-
fibrillated film
-
field-oxide film
-
fine-grain film
-
fire-proof film
-
flat film
-
flexible film
-
garnet film
-
gas film
-
getter film
-
glass film
-
glue film
-
graphic arts film
-
grown film
-
gussetted tubular film
-
hard film
-
hardened film
-
heat developable film
-
heat stabilized film
-
high clarity film
-
high-gamma film
-
high-impact film
-
high-speed color negative film
-
holographic film
-
hot tack film
-
hot-wall film
-
hydrodynamic oil film
-
hypersensitized film
-
imperforated film
-
imperforate film
-
indium-tin oxide film
-
industrial film
-
infrachromatic film
-
ink film
-
instant film
-
instructional film
-
instruction film
-
insulating film
-
intermediate film
-
internegative film
-
interpositive film
-
intrinsic film
-
iridescent film
-
ITO film
-
kapton film
-
laminar film
-
laminate film
-
laminated film
-
Langmuir-Blodgett film
-
large-grain film
-
lenticular film
-
light-control film
-
light-guiding film
-
light-sensitive film
-
light-struck film
-
line film
-
lith film
-
logging film
-
loop film
-
low defect film
-
low-friction film
-
low-gamma film
-
low-slip film
-
lubricant film
-
magnetic bubble film
-
magnetic film
-
masking film
-
matrix film
-
mechanized processing film
-
medical film
-
medium speed film
-
medium-grain film
-
metallized film
-
moistureproof film
-
motion-picture film
-
multilayer film
-
multireel film
-
multirow film
-
mylar film
-
name plate film
-
narrow-gage film
-
narrow film
-
negative film
-
news film
-
nonfogging film
-
nonsilver film
-
nonwettable film
-
normal film
-
offset film
-
oil bound film
-
oil film
-
oiliness film
-
one-edge perforated film
-
opal film
-
opaque film
-
opp film
-
oriented film
-
oriented polypropylene film
-
orthochromatic film
-
oven film
-
oxide film
-
oxidized film
-
panchromatic film
-
pan film
-
panoramic film
-
passivating film
-
patterned film
-
pearlescent film
-
peelable film
-
peel-off film
-
perforated film
-
photochromic film
-
photoconductor-thermoplastic film
-
photographic film
-
photoplastic recording film
-
photoresist film
-
phototechnical film
-
phototypesetting film
-
piezoelectric film
-
polarizer film
-
polarizing film
-
Polaroid film
-
polycrystalline film
-
polyethylene film
-
polyimide film
-
polymer film
-
positive film
-
prescreened film
-
print film
-
process film
-
professional film
-
protective film
-
publicity film
-
pure film
-
PVC film
-
RA film
-
radiographic film
-
rapid access film
-
raw film
-
recording film
-
reflecting film
-
released film
-
release film
-
resist film
-
resistance film
-
reversal film
-
ripple film
-
roll film
-
room daylight film
-
rust film
-
safety film
-
sandwich film
-
saran film
-
seismic film
-
self-developing film
-
semiconductor film
-
sensitized film
-
sheet film
-
short-length film
-
shrinkable film
-
shrink film
-
silent film
-
single-crystal film
-
single-oxide film
-
single-perforated film
-
single-wound film
-
sliced film
-
slide film
-
slit film
-
small-grain film
-
soft film
-
sound film
-
spacer film
-
split film
-
spray deposited film
-
sprocketed film
-
sputtered film
-
squeezed film
-
squeeze film
-
stacked film
-
standard film
-
steam film
-
steam-water film
-
stereoscopic film
-
stretch film
-
stretched film
-
stripping film
-
subminiature film
-
substrate film
-
superconducting film
-
support film
-
surface film
-
taped film
-
television film
-
test film
-
thermally grown film
-
thick film
-
thin film
-
tin oxide film
-
transfer film
-
transparency film
-
transparent film
-
trichromatic film
-
tubular film
-
TV film
-
unbalanced film
-
unsupported film
-
vapor film
-
vapor-deposited film
-
variable-area film
-
variable-density film
-
vesicular film
-
video film
-
washoff relief film
-
waster film
-
wear-inhibiting film
-
wedge-shaped oil film
-
wide-screen film
-
wrapping film
-
X-ray film -
17 компьютерная графика
1) General subject: CGI (computer generated images - АД), animated graphics2) Engineering: computer-generated graphics3) Architecture: (машинная) computer-graphics4) Cinema: computer graphics5) Mass media: computer graphicУниверсальный русско-английский словарь > компьютерная графика
-
18 levende
живо́й; оживлённыйlévende sprog — живо́й язы́к
* * *alive, animate, animated, living, live, lively, vivid* * *adj living ( fx a living creature; everything living; a living language (, hope, faith); he is still living; the living and the dead),(kun foran sb, ikke om person) live ( fx cattle, fish, plant; a real live elephant),(kun efter vb) alive ( fx he is still alive; be buried alive; keep hope alive);( livlig) lively;( virkelighedstro) lifelike ( fx portrait);(klar etc) vivid ( fx recollection, description); graphic ( fxdescription);adv vividly, intensely;[ levende billeder] moving pictures,(se også film);[ de levende] the living;[ levende hegn] quickset hedge;[ være levende interesseret i] take a lively interest in;[ komme (el. slippe) levende fra det] escape with one's life, survive;[ i levende live] while alive, during one's lifetime;[ levende lys] candles, candle light;[ med levende lys] lit by candles, candle-lit;[ efter levende model] from (the) life;[ det levende ord] the spoken word;(rel) the Word;[ ikke et levende ord] not a (blessed) word;[ ikke vide sine levende råd] be at one's wits' end;[ levende vægt] live weight;(se også unge). -
19 display
1) дисплей || дисплейный (напр. о пульте)2) устройство индикации, устройство цифровой индикации; устройство отображения, устройство отображения информации; электронное табло3) отображение, отображение информации; вывод ( данных на экран); индикация, индикация данных || отображать, отображать информацию; идентифицировать, идентифицировать данные4) экранный (напр. о мониторе)•- advanced integrated display
- alphanumeric display
- analog display
- animated display
- axis display
- axis position display
- band display
- bar-graph display
- bi-colored display
- character display
- color display
- computer controlled display
- computer display
- CRT display
- dashboard map display
- diagnostic display
- diagrammatic display
- digital display
- display-and-enter CRT display
- dot matrix display
- dynamic display
- electrical luminescence display
- fault display
- fluorescent display
- gas-plasma display
- graph display
- graphic tool path display
- graphical display
- graphics display
- graphics simulation display
- gray-scale display
- infrared touch display
- interaction CRT display
- keyboard display
- keypad display
- LCD display
- LED display
- light-emitting diode display
- liquid-crystal display display
- map display
- numeric display
- numerical display
- part graphics display
- plain language display
- position display
- professional graphics display
- raster scan video display
- raster video display
- readout display
- real-time rendered display
- refreshed display
- remote display of CNC control status
- remote display
- screen display
- seal touch display
- segment display
- sequence number display
- simulated display
- simulation display
- single-line LED display
- stereoscopic display
- storage display
- tooling data display
- touch display
- touch screen display
- trend display
- tutorial display
- vacuum fluorescent display
- vector display
- VFD display
- visual displayEnglish-Russian dictionary of mechanical engineering and automation > display
-
20 élénk
(DE) behende; belebt; flink; geweckt; lebendig; lebhaft; munter; quicklebendig; rege; regen; resch; Wiebel {r}; alert; queck; vif; wählig; (EN) active; agog; alive; animated; be in high spirits; bobbish; breezy; bright; brisk; buoyant; busy; cant; chipper; chirpy; chirrupy; corky; employment; flaring; gay; giggish; graphic; hot; intense; keen; lifesome; live; lively; living; mercurial; merry; nimble; nippy; perky; picturesque; quick; racy; racy of the soil; rattling; rich; skittish; smacking; smart; spirited; spiritful; sprightly; spruce; tittuppy; vigorous; vital; vivacious; vivid; warm
- 1
- 2
См. также в других словарях:
graphic novels — Graphic novels are comic books (see comics) of novel length published in hardback or paperback and unified by a main theme. They can be complete stories in comic book form, or serials collected into one book. Most graphic novels published in… … Encyclopedia of contemporary British culture
Graphic animation — was also used as a History of Playboy Magazine piece used on Saturday Night Live when the magazine s founder, Hugh Hefner, appeared on that show during the late 70s or early 80s.In its simplest form, Graphic animation can take the form of the… … Wikipedia
graphic design — the art or profession of visual communication that combines images, words, and ideas to convey information to an audience, esp. to produce a specific effect. * * * The art and profession of selecting and arranging visual elements such as… … Universalium
Animated cartoon — An animated cartoon is a short, hand drawn (or made with computers to look similar to something hand drawn) film for the cinema, television or computer screen, featuring some kind of story or plot (even if it is a very short one). This is… … Wikipedia
Graphic violence — Extreme violence redirects here. For the computer game, see Extreme Violence. Graphic violence is the depiction of especially vivid, brutal and realistic acts of violence in visual media such as literature, film, television, and video games. It… … Wikipedia
Graphic adventure game — A graphic adventure game is a form of adventure game [ [http://ps2.ign.com/objects/016/016196.html IGN: Escape From Monkey Island ] ] . They are distinct from text adventures. Whereas a player must actively observe using commands such as look in… … Wikipedia
List of Batman animated episodes — List of Batman episodes redirects here. For episodes of the live action television series, see List of Batman television episodes. For episodes of The Batman, see List of The Batman episodes. Batman: The Animated Series credits logo. The… … Wikipedia
Duckman: The Graphic Adventures of a Private Dick — Developer(s) The Illusions Game Company Publisher(s) Playmates Interactive Entertainment Platform(s) Microsoft Windows … Wikipedia
Joe Kubert School of Cartoon and Graphic Art — The Joe Kubert School of Cartoon and Graphic Art, or Joe Kubert School, located in Dover, New Jersey, is a three year technical school that teaches the principles of sequential art and the particular craft of the comics industry as well as… … Wikipedia
DC Universe Animated Original Movies — Logo for the film series Studio Warner Bros. Animation Warner Premiere DC Comics … Wikipedia
List of computer-animated films — A computer animated film commonly refers to feature films that have been computer animated to appear three dimensional on a movie screen. While traditional 2D animated films are now done primarily with the help of computers, the technique to… … Wikipedia